The echinoderm and flatworm mitochondrial code
The echinoderm and flatworm mitochondrial code (translation table 9) is a genetic code used by the mitochondria of certain echinoderm and flatworm species.[1]
The code
AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNNKSSSSVVVVAAAADDEEGGGG
Starts = -----------------------------------M---------------M------------
Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG
Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).
Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V) Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).
Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)
| This code | Standard | |
|---|---|---|
| AAA | Asn N | Lys K |
| AGA | Ser S | Arg R |
| AGG | Ser S | Arg R |
| UGA | Trp W | Ter * |
Systematic range
- Asterozoa (starfishes) [2]
- Echinozoa (sea urchins) [3][4]
- Rhabditophora among the Platyhelminthes[5]
See also
References
- This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski and Jim Ostell.[1]
- 1 2 "The Genetic Codes". Retrieved 18 March 2016.
- ↑ H. Himeno, H. Masaki, T. Kawai, T. Ohta, I. Kumagai, K. Miura, K. Watanabe (1987). "Unusual genetic codes and a novel gene structure for tRNA(AGYSer) in starfish mitochondrial DNA". Gene 56 (2-3): 219–30.
- ↑ H. T. Jacobs, D. J. Elliott, V. B. Math, A. Farquharson (20 July 1988). "Nucleotide sequence and gene organization of sea urchin mitochondrial DNA.". J Mol Biol 202 (2): 185-217.
- ↑ P. Cantatore, M. Roberti, G. Rainaldi, M. N. Gadaleta, C. Saccone (5 July 1989). "The complete nucleotide sequence, gene organization, and genetic code of the mitochondrial genome of Paracentrotus lividus". J Biol Chem 264 (19): 10965–75.
- ↑ M. J. Telford, E. A. Herniou, R. B. Russell, D. T. Littlewood (10 October 2000). "Changes in mitochondrial genetic codes as phylogenetic characters: two examples from the flatworms". Proc Natl Acad Sci U S A 97 (21): 11359–64.